PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc02906.1.g00090.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 303aa    MW: 32840.9 Da    PI: 7.9001
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc02906.1.g00090.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.41.6e-181461148
                                  TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
               Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                  +g+WT+eEd++l+ +++q+G g+W++ +++ g+ R++k+c++rw +yl
  Zmw_sc02906.1.g00090.1.sm.mk 14 KGPWTPEEDQKLLAYIEQHGHGCWRSLPAKAGLQRCGKSCRLRWTNYL 61
                                  79********************************************97 PP

2Myb_DNA-binding53.46.1e-1767112148
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                   rg+++ +E++ +++++++lG++ W++Ia +++ +Rt++++k++w+++l
  Zmw_sc02906.1.g00090.1.sm.mk  67 RGKFSLQEEQTIIQLHALLGNR-WSAIATHLP-KRTDNEIKNYWNTHL 112
                                   89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.3E-27564IPR009057Homeodomain-like
PROSITE profilePS5129419.026961IPR017930Myb domain
SuperFamilySSF466893.67E-3011108IPR009057Homeodomain-like
SMARTSM007171.3E-141363IPR001005SANT/Myb domain
PfamPF002491.2E-161461IPR001005SANT/Myb domain
CDDcd001671.01E-111661No hitNo description
PROSITE profilePS5129425.89162116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.6E-2665116IPR009057Homeodomain-like
SMARTSM007171.2E-1666114IPR001005SANT/Myb domain
PfamPF002493.2E-1667112IPR001005SANT/Myb domain
CDDcd001672.48E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 303 aa     Download sequence    Send to blast
MGRSPCCEKE GLKKGPWTPE EDQKLLAYIE QHGHGCWRSL PAKAGLQRCG KSCRLRWTNY  60
LRPDIKRGKF SLQEEQTIIQ LHALLGNRWS AIATHLPKRT DNEIKNYWNT HLKKRLAKMG  120
IDPVTHKPRS DALAAGGGGA QHAKAAAHLS HTAQWESARL EAEARLAREA KLRALAASAS  180
ASTSXXXXAA AARAALQPMQ AFEEEACGNK EQQHWGDVDV ADAGFAGVGF TGLLLDGSLS  240
QEDLRPAAGR DHVGVDAGLQ ETEEDKNYWN SILNLVNSSA ATASMPTSAV APAAEAYSPA  300
LEF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-27121165108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015635111.11e-150PREDICTED: myb-related protein Myb4-like
TrEMBLI1PLX91e-151I1PLX9_ORYGL; Uncharacterized protein
STRINGORGLA04G0119800.11e-151(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP7938563